PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03324.1.p
Common NameEUGRSUZ_B03324, LOC104433534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 238aa    MW: 27433.7 Da    PI: 7.1616
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03324.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-161259148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g WT+eEd ll+d ++ +G+g+W++I++  g++R +k+c++rw++yl
  Eucgr.B03324.1.p 12 KGLWTEEEDRLLLDHIRVHGPGRWNRIPKFTGLRRHGKSCRLRWLNYL 59
                      678*******************************************97 PP

2Myb_DNA-binding62.96.2e-2065110148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eEd+l+v+++k+lG++ W++Ia +++ gRt++q+k++w+++l
  Eucgr.B03324.1.p  65 RGKFSEEEDDLIVRLHKLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 110
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.524759IPR017930Myb domain
SuperFamilySSF466894.58E-3011106IPR009057Homeodomain-like
SMARTSM007174.3E-131161IPR001005SANT/Myb domain
PfamPF002491.1E-141259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-221366IPR009057Homeodomain-like
CDDcd001671.77E-111559No hitNo description
PROSITE profilePS5129427.7760114IPR017930Myb domain
SMARTSM007176.2E-1864112IPR001005SANT/Myb domain
PfamPF002492.8E-1865110IPR001005SANT/Myb domain
CDDcd001674.10E-1367110No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2567114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGAEAGESLH RKGLWTEEED RLLLDHIRVH GPGRWNRIPK FTGLRRHGKS CRLRWLNYLS  60
PAVKRGKFSE EEDDLIVRLH KLLGNRWSLI AGRVPGRTDN QVKNHWNTHL FKKLGTGNFK  120
RPRSDPKPEY RAQEEQETTD HHHPINDSNA GNCDRLPPCR STMSNTSADD AEVGDVLMRE  180
NFLTGSEGSD GEEWMRDHRV WLGSPMLSSD RYFELSNVGL EDLVIDSYSL DQMWRHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301211427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03324.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044624.11e-176PREDICTED: transcription factor WER-like
SwissprotQ9SEI02e-58WER_ARATH; Transcription factor WER
TrEMBLA0A059D8G81e-176A0A059D8G8_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g08480.t011e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-59myb domain protein 66